| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337693.1 | 5prime_partial | 107 | 335-12(-) |
Amino Acid sequence : | |||
| EILTRLMDDLAGHGKEEKIAAVSCYMKEYGCSEMEASRELWKQVKKAWKDLNDGWMEPRAASSEILACIIDQSRISNNLYSTGEDGFSDSTTRTKQFIKSLRGDRIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,168.603 | ||
| Theoretical pI: | 5.448 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 52.195 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.661 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.215 | ||
| sheet | 0.280 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337693.1 | 5prime_partial | 107 | 335-12(-) |
Amino Acid sequence : | |||
| EILTRLMDDLAGHGKEEKIAAVSCYMKEYGCSEMEASRELWKQVKKAWKDLNDGWMEPRAASSEILACIIDQSRISNNLYSTGEDGFSDSTTRTKQFIKSLRGDRIN* | |||
Physicochemical properties | |||
| Number of amino acids: | 107 | ||
| Molecular weight: | 12,168.603 | ||
| Theoretical pI: | 5.448 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21095 | ||
| Instability index: | 52.195 | ||
| aromaticity | 0.075 | ||
| GRAVY | -0.661 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.215 | ||
| sheet | 0.280 | ||