Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337698.1	internal	204	3-614(+)
Amino Acid sequence :
EVQPFAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVA
Physicochemical properties
Number of amino acids:		204
Molecular weight:		14,106.923
Theoretical pI:		11.558
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		71.436
aromaticity		0.040
GRAVY		-0.681
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337698.1	5prime_partial	126	2-382(+)
Amino Acid sequence :
RSSTLCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPL SQVDQR*
Physicochemical properties
Number of amino acids:		126
Molecular weight:		14,106.923
Theoretical pI:		11.558
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		71.436
aromaticity		0.040
GRAVY		-0.681
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337698.1	complete	125	416-39(-)
Amino Acid sequence :
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,106.923
Theoretical pI:		11.558
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		71.436
aromaticity		0.040
GRAVY		-0.681
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337698.1	internal	204	3-614(+)
Amino Acid sequence :
EVQPFAQAWEHALSYINSTALSAAVELEIPDILEDHGGLMSLSELSAASGCPREPLYRLMRFLIFHGIFTKSDDCYAQSPLSRLFTRENLGPYMLMQATPVTRSPAGLSGEALKTGTSLY LKSIRGEDSWSDPAYGYHMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVA
Physicochemical properties
Number of amino acids:		204
Molecular weight:		14,106.923
Theoretical pI:		11.558
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		71.436
aromaticity		0.040
GRAVY		-0.681
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337698.1	5prime_partial	126	2-382(+)
Amino Acid sequence :
RSSTLCTSMGARPKLHQLHGAVCGGGAGDSRHPGRSRRPDVAVGALRRLRLPPRAALPPHEIPHLPRHLHQIRRLLRPVAAFSAFHERESGTLHVDAGDAGNEVSCGLERRSLENGDKPL SQVDQR*
Physicochemical properties
Number of amino acids:		126
Molecular weight:		14,106.923
Theoretical pI:		11.558
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		71.436
aromaticity		0.040
GRAVY		-0.681
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337698.1	complete	125	416-39(-)
Amino Acid sequence :
MVAVGRVAPRILTSDRLEIKACPRFQGFAAQARRRPRYRRRLHQHVGSQILSREKPRKRRLGVAVVGFGEDAVEDEESHEAVERLAGAAGGGGELRQRHQAAVIFQDVGNLQLHRRRQRR GVDVT*
Physicochemical properties
Number of amino acids:		125
Molecular weight:		14,106.923
Theoretical pI:		11.558
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		1490 1490
Instability index:		71.436
aromaticity		0.040
GRAVY		-0.681
Secondary Structure Fraction
Helix		0.248
turn		0.176
sheet		0.264