Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337700.1 | internal | 230 | 2-691(+) |
Amino Acid sequence : | |||
LLRLKEMGVNILPPLDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLD GSSSTKEAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSHFISFNTICVGAQERQDATYNLIEEEVDMMIVIGGWNSSNTSSLQ | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,327.546 | ||
Theoretical pI: | 5.188 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 32.641 | ||
aromaticity | 0.078 | ||
GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.226 | ||
sheet | 0.243 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337700.1 | internal | 230 | 2-691(+) |
Amino Acid sequence : | |||
LLRLKEMGVNILPPLDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKYAHEETVATASFAGNYIVVENITEATYVCDYILGGGLD GSSSTKEAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSHFISFNTICVGAQERQDATYNLIEEEVDMMIVIGGWNSSNTSSLQ | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 25,327.546 | ||
Theoretical pI: | 5.188 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26930 27055 | ||
Instability index: | 32.641 | ||
aromaticity | 0.078 | ||
GRAVY | -0.169 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.226 | ||
sheet | 0.243 |