| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337701.1 | internal | 178 | 534-1(-) |
Amino Acid sequence : | |||
| YILGGGLDGSSSTKEAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSHFISFNTICVGAQERQDATEKLIEEEVDMMIVIGGWNSSNTSSMQVI TEERGIPSYWVDTPERIGPGNRIAHKLAHGELVEKEEWIPKGPVTIQISTGPSTPHNF | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,680.014 | ||
| Theoretical pI: | 5.421 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 27.131 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.281 | ||
| sheet | 0.230 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337701.1 | internal | 178 | 534-1(-) |
Amino Acid sequence : | |||
| YILGGGLDGSSSTKEAFLKKFKSAVSKGFDPDKHLEKVGIANQTTMLKGETEEIGKLVENSMMRRYGVENINSHFISFNTICVGAQERQDATEKLIEEEVDMMIVIGGWNSSNTSSMQVI TEERGIPSYWVDTPERIGPGNRIAHKLAHGELVEKEEWIPKGPVTIQISTGPSTPHNF | |||
Physicochemical properties | |||
| Number of amino acids: | 178 | ||
| Molecular weight: | 19,680.014 | ||
| Theoretical pI: | 5.421 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 20970 | ||
| Instability index: | 27.131 | ||
| aromaticity | 0.067 | ||
| GRAVY | -0.458 | ||
Secondary Structure Fraction | |||
| Helix | 0.270 | ||
| turn | 0.281 | ||
| sheet | 0.230 | ||