Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337711.1 | complete | 188 | 124-690(+) |
Amino Acid sequence : | |||
MFAGGFETPCILRRTGPLQFANPNRPLYAHLSTVDSTGQSMRLTWVSGDKSPQQVKYDGRNATSSVSTFSQANMCSSKALASPAVDFGWHDPGFIHSALLTRLSPSTNYSYKYGSDSVGW SEEIKMKTAAAGGSEELRFLAFGDMGKAPLDSSSEHYIQPGSVSVIKAMTEEISSGGVDTIYHIGDIS* | |||
Physicochemical properties | |||
Number of amino acids: | 188 | ||
Molecular weight: | 14,933.197 | ||
Theoretical pI: | 7.696 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 43.911 | ||
aromaticity | 0.089 | ||
GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.244 | ||
sheet | 0.281 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337711.1 | 3prime_partial | 135 | 407-3(-) |
Amino Acid sequence : | |||
MKPGSCHPKSTAGLANALLEHMLACENVETEEVAFRPSYFTCCGLLSPLTHVNLIDCPVESTVDKWAYKGRFGLANWSGPVLLKMQGVSKPPANITNSMSVRILTTWNDSEAEHVFTKHF PAMLFKRFVLATVHV | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 14,933.197 | ||
Theoretical pI: | 7.696 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
Instability index: | 43.911 | ||
aromaticity | 0.089 | ||
GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
Helix | 0.304 | ||
turn | 0.244 | ||
sheet | 0.281 |