| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337711.1 | complete | 188 | 124-690(+) |
Amino Acid sequence : | |||
| MFAGGFETPCILRRTGPLQFANPNRPLYAHLSTVDSTGQSMRLTWVSGDKSPQQVKYDGRNATSSVSTFSQANMCSSKALASPAVDFGWHDPGFIHSALLTRLSPSTNYSYKYGSDSVGW SEEIKMKTAAAGGSEELRFLAFGDMGKAPLDSSSEHYIQPGSVSVIKAMTEEISSGGVDTIYHIGDIS* | |||
Physicochemical properties | |||
| Number of amino acids: | 188 | ||
| Molecular weight: | 14,933.197 | ||
| Theoretical pI: | 7.696 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 43.911 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.244 | ||
| sheet | 0.281 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337711.1 | 3prime_partial | 135 | 407-3(-) |
Amino Acid sequence : | |||
| MKPGSCHPKSTAGLANALLEHMLACENVETEEVAFRPSYFTCCGLLSPLTHVNLIDCPVESTVDKWAYKGRFGLANWSGPVLLKMQGVSKPPANITNSMSVRILTTWNDSEAEHVFTKHF PAMLFKRFVLATVHV | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 14,933.197 | ||
| Theoretical pI: | 7.696 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 43.911 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.045 | ||
Secondary Structure Fraction | |||
| Helix | 0.304 | ||
| turn | 0.244 | ||
| sheet | 0.281 | ||