| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337713.1 | 5prime_partial | 102 | 634-326(-) |
Amino Acid sequence : | |||
| GKDTVSDSRWVSPRNELINLDEGGVGLQENVGELVGRVGSVEKRINVVILNEITTSCTQKMDSAGKCCICSTLSNLIHHFALPLPVVFQLLRQCHRPLQHLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,246.897 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 57.213 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.255 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337713.1 | 5prime_partial | 102 | 634-326(-) |
Amino Acid sequence : | |||
| GKDTVSDSRWVSPRNELINLDEGGVGLQENVGELVGRVGSVEKRINVVILNEITTSCTQKMDSAGKCCICSTLSNLIHHFALPLPVVFQLLRQCHRPLQHLI* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,246.897 | ||
| Theoretical pI: | 7.059 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5750 | ||
| Instability index: | 57.213 | ||
| aromaticity | 0.029 | ||
| GRAVY | 0.014 | ||
Secondary Structure Fraction | |||
| Helix | 0.333 | ||
| turn | 0.255 | ||
| sheet | 0.216 | ||