| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337721.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
| TRRRISSWVSLQIFRRTASHLHKKMWTIACTSSSAFIFNTSKESTDHPAPFSHFNGLKSLRIGSASFHVRPTPEKKNGKINAVVGRERDPKKRVVITGMGLVSVFGNDVDTFYDKLLDGV SGVGRIERFDASEFPVRIAGEIRNFSSEGYIDGKNDRRLDDCWRYCLVAGKKALHHANLTKQALATMEMSRMGVVVRSGMGGLTTISNGVENLIQRGYKTI | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,649.977 | ||
| Theoretical pI: | 10.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 45.240 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.352 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.258 | ||
| sheet | 0.190 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337721.1 | internal | 221 | 1-663(+) |
Amino Acid sequence : | |||
| TRRRISSWVSLQIFRRTASHLHKKMWTIACTSSSAFIFNTSKESTDHPAPFSHFNGLKSLRIGSASFHVRPTPEKKNGKINAVVGRERDPKKRVVITGMGLVSVFGNDVDTFYDKLLDGV SGVGRIERFDASEFPVRIAGEIRNFSSEGYIDGKNDRRLDDCWRYCLVAGKKALHHANLTKQALATMEMSRMGVVVRSGMGGLTTISNGVENLIQRGYKTI | |||
Physicochemical properties | |||
| Number of amino acids: | 221 | ||
| Molecular weight: | 24,649.977 | ||
| Theoretical pI: | 10.133 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 22460 22585 | ||
| Instability index: | 45.240 | ||
| aromaticity | 0.081 | ||
| GRAVY | -0.352 | ||
Secondary Structure Fraction | |||
| Helix | 0.285 | ||
| turn | 0.258 | ||
| sheet | 0.190 | ||