| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337723.1 | internal | 198 | 1-594(+) |
Amino Acid sequence : | |||
| NNXGFLDSNLPFDLNDNKQVSLPTATVDGPAPPVGALSKALTRLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEM PAPGPVLIHIITEKGKGYPPAEVAAHKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVLAIHAAMGG | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 12,838.808 | ||
| Theoretical pI: | 8.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 52.647 | ||
| aromaticity | 0.138 | ||
| GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.193 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337723.1 | 5prime_partial | 109 | 594-265(-) |
Amino Acid sequence : | |||
| APHGRVDGEYFVVLLRFGDEGLGEVLCVGFCACFGLHLFTGRWIELHHTMHFMCSNFSRRIAFALLRDDVDQHRSRRWHLLYFLENINKIFHTVPINWSNVINPKLLKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,838.808 | ||
| Theoretical pI: | 8.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 52.647 | ||
| aromaticity | 0.138 | ||
| GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.193 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337723.1 | internal | 198 | 1-594(+) |
Amino Acid sequence : | |||
| NNXGFLDSNLPFDLNDNKQVSLPTATVDGPAPPVGALSKALTRLQASRKFRQLREAAKGMTKQMGNQAHEIASKVDTYVKGMMGKPGASLFEELGIYYIGPVDGHSVEDLVYIFKKVKEM PAPGPVLIHIITEKGKGYPPAEVAAHKMHGVVKFDPTTGKQMKAKTSTKSYTQYFAESLVAEAEQDDKVLAIHAAMGG | |||
Physicochemical properties | |||
| Number of amino acids: | 198 | ||
| Molecular weight: | 12,838.808 | ||
| Theoretical pI: | 8.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 52.647 | ||
| aromaticity | 0.138 | ||
| GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.193 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337723.1 | 5prime_partial | 109 | 594-265(-) |
Amino Acid sequence : | |||
| APHGRVDGEYFVVLLRFGDEGLGEVLCVGFCACFGLHLFTGRWIELHHTMHFMCSNFSRRIAFALLRDDVDQHRSRRWHLLYFLENINKIFHTVPINWSNVINPKLLKK* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 12,838.808 | ||
| Theoretical pI: | 8.851 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 19480 19730 | ||
| Instability index: | 52.647 | ||
| aromaticity | 0.138 | ||
| GRAVY | 0.028 | ||
Secondary Structure Fraction | |||
| Helix | 0.394 | ||
| turn | 0.193 | ||
| sheet | 0.229 | ||