| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337734.1 | internal | 190 | 2-571(+) |
Amino Acid sequence : | |||
| GNYIQPLKHNMDISLSTEQLLQAQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTV APLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLPNNPTMGRFFDEPMTCDSRLVAHVLT | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,833.839 | ||
| Theoretical pI: | 6.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 43.125 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.232 | ||
| sheet | 0.284 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337734.1 | internal | 190 | 2-571(+) |
Amino Acid sequence : | |||
| GNYIQPLKHNMDISLSTEQLLQAQAHVWNHMYAFANSMSLKCAIQLGIPDILHKHDHPMTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTV APLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLPNNPTMGRFFDEPMTCDSRLVAHVLT | |||
Physicochemical properties | |||
| Number of amino acids: | 190 | ||
| Molecular weight: | 21,833.839 | ||
| Theoretical pI: | 6.573 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 33460 33710 | ||
| Instability index: | 43.125 | ||
| aromaticity | 0.100 | ||
| GRAVY | -0.258 | ||
Secondary Structure Fraction | |||
| Helix | 0.305 | ||
| turn | 0.232 | ||
| sheet | 0.284 | ||