| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337749.1 | internal | 110 | 330-1(-) |
Amino Acid sequence : | |||
| CYHLPIRLRGNVATFMPVQILELLLLDMPPQEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPDVTRCNWDAVENNHGCFLLRKYWQCRIFSFCGGARSNTAVVYVR | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,515.231 | ||
| Theoretical pI: | 5.720 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 42.839 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.245 | ||
| sheet | 0.218 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337749.1 | internal | 110 | 330-1(-) |
Amino Acid sequence : | |||
| CYHLPIRLRGNVATFMPVQILELLLLDMPPQEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPDVTRCNWDAVENNHGCFLLRKYWQCRIFSFCGGARSNTAVVYVR | |||
Physicochemical properties | |||
| Number of amino acids: | 110 | ||
| Molecular weight: | 12,515.231 | ||
| Theoretical pI: | 5.720 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 20970 21220 | ||
| Instability index: | 42.839 | ||
| aromaticity | 0.091 | ||
| GRAVY | -0.099 | ||
Secondary Structure Fraction | |||
| Helix | 0.336 | ||
| turn | 0.245 | ||
| sheet | 0.218 | ||