| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337751.1 | internal | 213 | 3-641(+) |
Amino Acid sequence : | |||
| REGGPLMEISVGTIDVNGFSAKHVSADYYLVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQK LKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLCFPGYG | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 11,732.363 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 44.453 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.235 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337751.1 | complete | 102 | 383-75(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,732.363 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 44.453 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.235 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337751.1 | internal | 213 | 3-641(+) |
Amino Acid sequence : | |||
| REGGPLMEISVGTIDVNGFSAKHVSADYYLVPPYVYYGRITPNAATKTKDATLPVVPEEKTAMIVFYCIPVTPGYSRLIYAGARNFAVQIDRFVPRWITHMSHNLIFDSDLFLLHVEEQK LKDLDWHKSCYIPTKADGQVVAFRRWLNKYGGTQVDWRNNFTPALPPTPSREQLFDRYWSHTAECSSCSVACKRLNALEIGLQAMSLCFPGYG | |||
Physicochemical properties | |||
| Number of amino acids: | 213 | ||
| Molecular weight: | 11,732.363 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 44.453 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.235 | ||
| sheet | 0.216 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337751.1 | complete | 102 | 383-75(-) |
Amino Acid sequence : | |||
| MPVQILELLLLDMKKKEIGIKNQVVGHMSDPAWHESINLDSEIPGTSVDEPAVTRCNWDAVENNHGCFLLRNYWQRRIFSFCGGVWSNTAVVYVRWNEVVIC* | |||
Physicochemical properties | |||
| Number of amino acids: | 102 | ||
| Molecular weight: | 11,732.363 | ||
| Theoretical pI: | 5.492 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 30480 30730 | ||
| Instability index: | 44.453 | ||
| aromaticity | 0.098 | ||
| GRAVY | -0.073 | ||
Secondary Structure Fraction | |||
| Helix | 0.363 | ||
| turn | 0.235 | ||
| sheet | 0.216 | ||