Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337760.1 | internal | 237 | 2-712(+) |
Amino Acid sequence : | |||
HAFYITNLPGAAERLLIFNADLDKPETFVPAIQGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRRVVYTSSISAAAFGSATNSEGLVDENSWTDVDLIRSLKTFGG PYIGAKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDASHYQHLKDSSLVHVDDVARAHIHLLEYPEAKGRYIVKGPEFKIEELCDFLSARYPQYKMPS | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 18,498.676 | ||
Theoretical pI: | 11.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 83.647 | ||
aromaticity | 0.057 | ||
GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.270 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337760.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
ARVLHHQPPRRGGATTYLQRRPRQAGDIRAGDTRMQRRLPHGSPSRLCRERIGGSKAEASHRRLTRHPAGLRRFQHSPPRCLHFQHLRRGLWLRHKLRRPRRREFVDRRGSDPQPEDIRR AVHRGENVDGEGSYRSGREAGIRPGYGGSYVDSRPFHLP* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,498.676 | ||
Theoretical pI: | 11.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 83.647 | ||
aromaticity | 0.057 | ||
GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.270 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337760.1 | internal | 237 | 2-712(+) |
Amino Acid sequence : | |||
HAFYITNLPGAAERLLIFNADLDKPETFVPAIQGCSGVFHMAHPLDFAEKESEEVKLKRVTAGLQGILQACADSNTVRRVVYTSSISAAAFGSATNSEGLVDENSWTDVDLIRSLKTFGG PYIGAKTLTEKAAIDLGEKLGLDLVTVVPTWTHGPFICPNFPDSVYVAMALILGDASHYQHLKDSSLVHVDDVARAHIHLLEYPEAKGRYIVKGPEFKIEELCDFLSARYPQYKMPS | |||
Physicochemical properties | |||
Number of amino acids: | 237 | ||
Molecular weight: | 18,498.676 | ||
Theoretical pI: | 11.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 83.647 | ||
aromaticity | 0.057 | ||
GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.270 | ||
sheet | 0.182 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337760.1 | 5prime_partial | 159 | 1-480(+) |
Amino Acid sequence : | |||
ARVLHHQPPRRGGATTYLQRRPRQAGDIRAGDTRMQRRLPHGSPSRLCRERIGGSKAEASHRRLTRHPAGLRRFQHSPPRCLHFQHLRRGLWLRHKLRRPRRREFVDRRGSDPQPEDIRR AVHRGENVDGEGSYRSGREAGIRPGYGGSYVDSRPFHLP* | |||
Physicochemical properties | |||
Number of amino acids: | 159 | ||
Molecular weight: | 18,498.676 | ||
Theoretical pI: | 11.858 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11585 | ||
Instability index: | 83.647 | ||
aromaticity | 0.057 | ||
GRAVY | -1.318 | ||
Secondary Structure Fraction | |||
Helix | 0.189 | ||
turn | 0.270 | ||
sheet | 0.182 |