Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337761.1 | 5prime_partial | 227 | 3-686(+) |
Amino Acid sequence : | |||
TPLSFFIIFHFLFTSPFSHDSSEILYEIYPFIKVYKNGSFERLSGTEIVPPSQNSNSRVLSKDVIIDPTLNISARLFRPNAAARKLPLLVYFHGGAFFTESPFSPTYHNYLNYVVSKANI VAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRNDVDFDRVYLGGDSAGGNIAHNVAMRVGTEKMECDDKGIMVHGLFLNCPHFWGSSRIGNEASFP* | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,615.745 | ||
Theoretical pI: | 6.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
Instability index: | 44.796 | ||
aromaticity | 0.145 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.300 | ||
sheet | 0.207 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337761.1 | 5prime_partial | 227 | 3-686(+) |
Amino Acid sequence : | |||
TPLSFFIIFHFLFTSPFSHDSSEILYEIYPFIKVYKNGSFERLSGTEIVPPSQNSNSRVLSKDVIIDPTLNISARLFRPNAAARKLPLLVYFHGGAFFTESPFSPTYHNYLNYVVSKANI VAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRNDVDFDRVYLGGDSAGGNIAHNVAMRVGTEKMECDDKGIMVHGLFLNCPHFWGSSRIGNEASFP* | |||
Physicochemical properties | |||
Number of amino acids: | 227 | ||
Molecular weight: | 25,615.745 | ||
Theoretical pI: | 6.671 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 38390 38515 | ||
Instability index: | 44.796 | ||
aromaticity | 0.145 | ||
GRAVY | -0.093 | ||
Secondary Structure Fraction | |||
Helix | 0.361 | ||
turn | 0.300 | ||
sheet | 0.207 |