| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337762.1 | 5prime_partial | 230 | 735-43(-) |
Amino Acid sequence : | |||
| KANIVAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRNDVDFDRVYLGGDSAGGNIAHNVAMRVGTEKMECDDKGIMVHGLFLNCPHFWGSSRIGNEASFPKAMTETEES IWIHAYPTSSGFDDPASNPGKDPNLWKLGCKKVLVYVAGNDVLKERGLYYAKVLKESGWRGGVKSVEVKGENHVFNLKFPYNRDARDMMGNVALFLNDKLKRGHNTYTSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 15,864.583 | ||
| Theoretical pI: | 11.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 52.706 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.199 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337762.1 | complete | 136 | 157-567(+) |
Amino Acid sequence : | |||
| MIFPLHLHTLDTSSPSTLFQHLGIIQPPLFQHIIPCNINQHFFTPQLPKIRILTRIRRRVIKPARSWVCMDPYTLLRLGHRFRKTRFIPNSATSPEMWTVQKQTMDHNTLIITLHLLRPH PHRHVVRDVAAGAVPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,864.583 | ||
| Theoretical pI: | 11.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 52.706 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.199 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337762.1 | 5prime_partial | 230 | 735-43(-) |
Amino Acid sequence : | |||
| KANIVAVSVNYRLAPEYLLPTAYQDCWLALKWVFSHSNGNGNEKWLRNDVDFDRVYLGGDSAGGNIAHNVAMRVGTEKMECDDKGIMVHGLFLNCPHFWGSSRIGNEASFPKAMTETEES IWIHAYPTSSGFDDPASNPGKDPNLWKLGCKKVLVYVAGNDVLKERGLYYAKVLKESGWRGGVKSVEVKGENHVFNLKFPYNRDARDMMGNVALFLNDKLKRGHNTYTSN* | |||
Physicochemical properties | |||
| Number of amino acids: | 230 | ||
| Molecular weight: | 15,864.583 | ||
| Theoretical pI: | 11.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 52.706 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.199 | ||
| sheet | 0.191 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337762.1 | complete | 136 | 157-567(+) |
Amino Acid sequence : | |||
| MIFPLHLHTLDTSSPSTLFQHLGIIQPPLFQHIIPCNINQHFFTPQLPKIRILTRIRRRVIKPARSWVCMDPYTLLRLGHRFRKTRFIPNSATSPEMWTVQKQTMDHNTLIITLHLLRPH PHRHVVRDVAAGAVPA* | |||
Physicochemical properties | |||
| Number of amino acids: | 136 | ||
| Molecular weight: | 15,864.583 | ||
| Theoretical pI: | 11.665 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 52.706 | ||
| aromaticity | 0.074 | ||
| GRAVY | -0.127 | ||
Secondary Structure Fraction | |||
| Helix | 0.331 | ||
| turn | 0.199 | ||
| sheet | 0.191 | ||