Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337763.1	internal	222	2-667(+)
Amino Acid sequence :
VNEPPLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANK ISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFRSTAAQSMTKRPMKGMLT
Physicochemical properties
Number of amino acids:		222
Molecular weight:		13,589.412
Theoretical pI:		5.657
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38625
Instability index:		37.626
aromaticity		0.083
GRAVY		0.128
Secondary Structure Fraction
Helix		0.392
turn		0.233
sheet		0.317

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337763.1	complete	123	234-605(+)
Amino Acid sequence :
MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAVLSHQSSTVMSVA QSQ*
Physicochemical properties
Number of amino acids:		123
Molecular weight:		13,589.412
Theoretical pI:		5.657
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38625
Instability index:		37.626
aromaticity		0.083
GRAVY		0.128
Secondary Structure Fraction
Helix		0.392
turn		0.233
sheet		0.317

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337763.1	5prime_partial	120	667-305(-)
Amino Acid sequence :
SKHSLHWALGHALGGSRPENSHWLWATDITVDDWWLNTARSVGLHPAICCEGKTRQLLSKVLNHIVSLWLSMNKNINVELFLQLDNLVDLFLDCLNVLLLGDLVGLEFTAHSSELHSLWE *
Physicochemical properties
Number of amino acids:		120
Molecular weight:		13,589.412
Theoretical pI:		5.657
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38625
Instability index:		37.626
aromaticity		0.083
GRAVY		0.128
Secondary Structure Fraction
Helix		0.392
turn		0.233
sheet		0.317

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337763.1	internal	222	2-667(+)
Amino Acid sequence :
VNEPPLDQEIKSWLAFAAQKIVEVNALAKALAGHKDEAFFSANAAAQASRKSSPRVNNEAVQKAAAALRGSDHRRATNVSARLDAQQKKLNLPILPTTTIGSFPQTVELRRVRREFKANK ISEEEYIKAIKEEINKVVKLQEELDIDVLVHGEPERNDMVEYFGEQLSGFAFTANGWVQSYGSRCVKPPIIYGDVSRPKPMTVFRSTAAQSMTKRPMKGMLT
Physicochemical properties
Number of amino acids:		222
Molecular weight:		13,589.412
Theoretical pI:		5.657
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38625
Instability index:		37.626
aromaticity		0.083
GRAVY		0.128
Secondary Structure Fraction
Helix		0.392
turn		0.233
sheet		0.317

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337763.1	complete	123	234-605(+)
Amino Acid sequence :
MSVPDLMLSRRSLTFRSCLPLLLVHSHRLWSSEECAVNSRPTRSPRRSTLRQSRKRSTRLSSCRKSSTLMFLFMESQRETIWLSTLESNCLVLPSQQMAGCNPTDLAVLSHQSSTVMSVA QSQ*
Physicochemical properties
Number of amino acids:		123
Molecular weight:		13,589.412
Theoretical pI:		5.657
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38625
Instability index:		37.626
aromaticity		0.083
GRAVY		0.128
Secondary Structure Fraction
Helix		0.392
turn		0.233
sheet		0.317

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337763.1	5prime_partial	120	667-305(-)
Amino Acid sequence :
SKHSLHWALGHALGGSRPENSHWLWATDITVDDWWLNTARSVGLHPAICCEGKTRQLLSKVLNHIVSLWLSMNKNINVELFLQLDNLVDLFLDCLNVLLLGDLVGLEFTAHSSELHSLWE *
Physicochemical properties
Number of amino acids:		120
Molecular weight:		13,589.412
Theoretical pI:		5.657
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		38500 38625
Instability index:		37.626
aromaticity		0.083
GRAVY		0.128
Secondary Structure Fraction
Helix		0.392
turn		0.233
sheet		0.317