| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337765.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
| ARCKGSYKEVAVAAPPFDLKPLLEKVEELSEEKTDNQICISPKEATQQDGSEGVSLDDSLPDHGDAKGDDERDTQETGSESTHSASGIQETQSSHNQEKTVETNGSKLSAAAQPYSPSVF ALTHSLQSTASISVYDALASQGTLTEPVGFPSVAAPVACGPRSSMYYGATQGFRVRPGVLNYQLPFNERNGVSPPKAMNPHAPEYVPKRAAWQANAATEDSKPTTDSELATDSNTVDDIG SG | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 25,603.516 | ||
| Theoretical pI: | 4.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 52.193 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.194 | ||
| turn | 0.306 | ||
| sheet | 0.252 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337765.1 | internal | 242 | 1-726(+) |
Amino Acid sequence : | |||
| ARCKGSYKEVAVAAPPFDLKPLLEKVEELSEEKTDNQICISPKEATQQDGSEGVSLDDSLPDHGDAKGDDERDTQETGSESTHSASGIQETQSSHNQEKTVETNGSKLSAAAQPYSPSVF ALTHSLQSTASISVYDALASQGTLTEPVGFPSVAAPVACGPRSSMYYGATQGFRVRPGVLNYQLPFNERNGVSPPKAMNPHAPEYVPKRAAWQANAATEDSKPTTDSELATDSNTVDDIG SG | |||
Physicochemical properties | |||
| Number of amino acids: | 242 | ||
| Molecular weight: | 25,603.516 | ||
| Theoretical pI: | 4.616 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 15930 16055 | ||
| Instability index: | 52.193 | ||
| aromaticity | 0.054 | ||
| GRAVY | -0.686 | ||
Secondary Structure Fraction | |||
| Helix | 0.194 | ||
| turn | 0.306 | ||
| sheet | 0.252 | ||