| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337771.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
| HPVKMSVVLINPTTNPLNTICAKDVHGGRRSKSILSSRATFSVSAILTQTKDSSTSPQFDIKKYMVEKANSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEES TAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVNAEGMA | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 19,365.850 | ||
| Theoretical pI: | 11.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.464 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.200 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337771.1 | 5prime_partial | 197 | 669-76(-) |
Amino Acid sequence : | |||
| AIPSALTSTTCPPDSPSDPIKFASSRTALTTLSGATPLVAAATCSNANDSMASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIKDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGR TLLPPARREYLMDSWISTGSFSWIAASKALFTEFAFSTMYFLISNCGEVDESLVWVRIAETEKVARDERIDLDLRPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 19,365.850 | ||
| Theoretical pI: | 11.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.464 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.200 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337771.1 | 5prime_partial | 170 | 670-158(-) |
Amino Acid sequence : | |||
| RHPLRVDVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTGRDAEDRP HSLAASEKGIPHGLVDLYWLLQLDCCFQGSVHGIRLLHHVFLDIELRRSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,365.850 | ||
| Theoretical pI: | 11.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.464 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.200 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337771.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
| HPVKMSVVLINPTTNPLNTICAKDVHGGRRSKSILSSRATFSVSAILTQTKDSSTSPQFDIKKYMVEKANSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEES TAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVNAEGMA | |||
Physicochemical properties | |||
| Number of amino acids: | 223 | ||
| Molecular weight: | 19,365.850 | ||
| Theoretical pI: | 11.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.464 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.200 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337771.1 | 5prime_partial | 197 | 669-76(-) |
Amino Acid sequence : | |||
| AIPSALTSTTCPPDSPSDPIKFASSRTALTTLSGATPLVAAATCSNANDSMASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIKDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGR TLLPPARREYLMDSWISTGSFSWIAASKALFTEFAFSTMYFLISNCGEVDESLVWVRIAETEKVARDERIDLDLRPP* | |||
Physicochemical properties | |||
| Number of amino acids: | 197 | ||
| Molecular weight: | 19,365.850 | ||
| Theoretical pI: | 11.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.464 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.200 | ||
| sheet | 0.229 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337771.1 | 5prime_partial | 170 | 670-158(-) |
Amino Acid sequence : | |||
| RHPLRVDVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTGRDAEDRP HSLAASEKGIPHGLVDLYWLLQLDCCFQGSVHGIRLLHHVFLDIELRRSR* | |||
Physicochemical properties | |||
| Number of amino acids: | 170 | ||
| Molecular weight: | 19,365.850 | ||
| Theoretical pI: | 11.177 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
| Instability index: | 53.464 | ||
| aromaticity | 0.035 | ||
| GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
| Helix | 0.288 | ||
| turn | 0.200 | ||
| sheet | 0.229 | ||