Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337771.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
HPVKMSVVLINPTTNPLNTICAKDVHGGRRSKSILSSRATFSVSAILTQTKDSSTSPQFDIKKYMVEKANSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEES TAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVNAEGMA | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 19,365.850 | ||
Theoretical pI: | 11.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.464 | ||
aromaticity | 0.035 | ||
GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.200 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337771.1 | 5prime_partial | 197 | 669-76(-) |
Amino Acid sequence : | |||
AIPSALTSTTCPPDSPSDPIKFASSRTALTTLSGATPLVAAATCSNANDSMASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIKDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGR TLLPPARREYLMDSWISTGSFSWIAASKALFTEFAFSTMYFLISNCGEVDESLVWVRIAETEKVARDERIDLDLRPP* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 19,365.850 | ||
Theoretical pI: | 11.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.464 | ||
aromaticity | 0.035 | ||
GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.200 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337771.1 | 5prime_partial | 170 | 670-158(-) |
Amino Acid sequence : | |||
RHPLRVDVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTGRDAEDRP HSLAASEKGIPHGLVDLYWLLQLDCCFQGSVHGIRLLHHVFLDIELRRSR* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,365.850 | ||
Theoretical pI: | 11.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.464 | ||
aromaticity | 0.035 | ||
GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.200 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337771.1 | internal | 223 | 2-670(+) |
Amino Acid sequence : | |||
HPVKMSVVLINPTTNPLNTICAKDVHGGRRSKSILSSRATFSVSAILTQTKDSSTSPQFDIKKYMVEKANSVNRALEAAIQLKEPVEIHESMRYSLLAGGKRVRPILCITACELVGGEES TAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVNAEGMA | |||
Physicochemical properties | |||
Number of amino acids: | 223 | ||
Molecular weight: | 19,365.850 | ||
Theoretical pI: | 11.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.464 | ||
aromaticity | 0.035 | ||
GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.200 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337771.1 | 5prime_partial | 197 | 669-76(-) |
Amino Acid sequence : | |||
AIPSALTSTTCPPDSPSDPIKFASSRTALTTLSGATPLVAAATCSNANDSMASPASTAAFSPNTLWLVGFPRRRSSLSMQGRSSCIKDMVWIISTAQAAGMAVDSSPPTSSQAVMQRIGR TLLPPARREYLMDSWISTGSFSWIAASKALFTEFAFSTMYFLISNCGEVDESLVWVRIAETEKVARDERIDLDLRPP* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 19,365.850 | ||
Theoretical pI: | 11.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.464 | ||
aromaticity | 0.035 | ||
GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.200 | ||
sheet | 0.229 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337771.1 | 5prime_partial | 170 | 670-158(-) |
Amino Acid sequence : | |||
RHPLRVDVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTGRDAEDRP HSLAASEKGIPHGLVDLYWLLQLDCCFQGSVHGIRLLHHVFLDIELRRSR* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 19,365.850 | ||
Theoretical pI: | 11.177 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 7115 | ||
Instability index: | 53.464 | ||
aromaticity | 0.035 | ||
GRAVY | -0.588 | ||
Secondary Structure Fraction | |||
Helix | 0.288 | ||
turn | 0.200 | ||
sheet | 0.229 |