| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337772.1 | 5prime_partial | 244 | 782-48(-) |
Amino Acid sequence : | |||
| ITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLD HLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHFDPHRAAPLIALAGYIA YRDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 13,691.349 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 59.081 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.826 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.215 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337772.1 | 5prime_partial | 151 | 2-457(+) |
Amino Acid sequence : | |||
| LHNWFLILLSTYKIYVNNLCKQYTLREQSRGQPCADQSEAGVPLPPDSICRPILWISPAQSALDTWLYPPPNPSRPSSPIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQPP PEPPTPAPAPPSSGGGSTPDDRVPRPPSPPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 13,691.349 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 59.081 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.826 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.215 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337772.1 | 3prime_partial | 121 | 420-782(+) |
Amino Acid sequence : | |||
| MIESHGRHPLRADVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTGR D | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,691.349 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 59.081 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.826 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.215 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337772.1 | 5prime_partial | 244 | 782-48(-) |
Amino Acid sequence : | |||
| ITACELVGGEESTAMPAACAVEMIQTMSLMHDDLPCMDNDDLRRGKPTNHKVFGENAAVLAGDAMLSFAFEHVAAATRGVAPERVVRAVRELANLIGSEGLSGGQVVDVSAEGMAAVGLD HLELIHRLKTAALVQASVVLGAVVGGASEEEIEKLRRFASCIGLLFQVVDDILDVTKSSAELGKTAGKDLAADKATYPKLIGLEKSRELADKLNREAKEHLLHFDPHRAAPLIALAGYIA YRDY* | |||
Physicochemical properties | |||
| Number of amino acids: | 244 | ||
| Molecular weight: | 13,691.349 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 59.081 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.826 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.215 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337772.1 | 5prime_partial | 151 | 2-457(+) |
Amino Acid sequence : | |||
| LHNWFLILLSTYKIYVNNLCKQYTLREQSRGQPCADQSEAGVPLPPDSICRPILWISPAQSALDTWLYPPPNPSRPSSPIPPTISSHPECRPPPETAALYSSQISSISQFPPRSLLPQPP PEPPTPAPAPPSSGGGSTPDDRVPRPPSPPR* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 13,691.349 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 59.081 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.826 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.215 | ||
| sheet | 0.215 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337772.1 | 3prime_partial | 121 | 420-782(+) |
Amino Acid sequence : | |||
| MIESHGRHPLRADVHHLPPRQPLRPDQIRQLPHRPHHSLRRHAPRRRGHVFERERQHGVPGQHRRVLAEHLVVGGLPAAEVVVVHAGQVVVHQGHGLDHLDGAGRRHGRGFLATDQLTGR D | |||
Physicochemical properties | |||
| Number of amino acids: | 121 | ||
| Molecular weight: | 13,691.349 | ||
| Theoretical pI: | 11.766 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
| Instability index: | 59.081 | ||
| aromaticity | 0.017 | ||
| GRAVY | -0.826 | ||
Secondary Structure Fraction | |||
| Helix | 0.240 | ||
| turn | 0.215 | ||
| sheet | 0.215 | ||