Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337774.1	complete	189	138-707(+)
Amino Acid sequence :
MQSFSSFSPKYLVFALIIQSVVKLSFCEEGFCSAPPILEKQPLYWKATNPTLSPSHLQDLPGFTRSVYKSDHALITPESHVFSPLPDWSNTLAAYLITPAMGSHFAMYLAKMQENSKSGV PPKDVERFVFVLQGVVTLTDTHGAKHKLEVDSYAYLPPNSKHSLKSDASATLVLFERRYEYLENHSTSR*
Physicochemical properties
Number of amino acids:		189
Molecular weight:		12,342.994
Theoretical pI:		9.800
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3230
Instability index:		47.914
aromaticity		0.055
GRAVY		-0.636
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.248

Acc_NO	ORF type	length	start-end position (strand +/-)
>DY337774.1	5prime_partial	110	2-334(+)
Amino Acid sequence :
KXPKYHPLNPPLSSRLFKNKKSHKKENKNTDRERQNSKSAHCQGKDAIFLFIFTQISRLCSNYSECCETLILRRRVLLCATNLGEAASLLESHQSNSLSLSSSRLAGIHT*
Physicochemical properties
Number of amino acids:		110
Molecular weight:		12,342.994
Theoretical pI:		9.800
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines-		2980 3230
Instability index:		47.914
aromaticity		0.055
GRAVY		-0.636
Secondary Structure Fraction
Helix		0.248
turn		0.284
sheet		0.248