| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337779.1 | 5prime_partial | 128 | 433-47(-) |
Amino Acid sequence : | |||
| HEASCRIRHEDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALSK EKKERPRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,123.251 | ||
| Theoretical pI: | 10.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 24.960 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.227 | ||
| sheet | 0.227 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337779.1 | 5prime_partial | 128 | 433-47(-) |
Amino Acid sequence : | |||
| HEASCRIRHEDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALSK EKKERPRS* | |||
Physicochemical properties | |||
| Number of amino acids: | 128 | ||
| Molecular weight: | 14,123.251 | ||
| Theoretical pI: | 10.016 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 24.960 | ||
| aromaticity | 0.055 | ||
| GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
| Helix | 0.281 | ||
| turn | 0.227 | ||
| sheet | 0.227 | ||