Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337779.1 | 5prime_partial | 128 | 433-47(-) |
Amino Acid sequence : | |||
HEASCRIRHEDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALSK EKKERPRS* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,123.251 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 24.960 | ||
aromaticity | 0.055 | ||
GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.227 | ||
sheet | 0.227 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337779.1 | 5prime_partial | 128 | 433-47(-) |
Amino Acid sequence : | |||
HEASCRIRHEDYKKAHLGTRWKANPFGGASHAKGIVLEKVGVEAKQPNSAIRKCVRVQLIKNGKKITAFVPRDGCLNYIEENDEVLVAGFGRKGHAVGDIPGVRFKVVKVANVSLLALSK EKKERPRS* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,123.251 | ||
Theoretical pI: | 10.016 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 24.960 | ||
aromaticity | 0.055 | ||
GRAVY | -0.456 | ||
Secondary Structure Fraction | |||
Helix | 0.281 | ||
turn | 0.227 | ||
sheet | 0.227 |