| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337790.1 | 5prime_partial | 195 | 644-57(-) |
Amino Acid sequence : | |||
| TYGDEKFVSMAEIVASDDAVKDRVHIVYGLSKDFCIPGFRVGVIYSFNDNVLKASKKLARFFSVSTPTQQILAPILSDKRFIREYINPNRQRIRSMYDLFVSGLREVGLEYTTSSGGLYC WVDMSKLISPYNEKGELDLWEKLLNIAKINVTPGSACHCIEPGWFRFCFTTLKEKEIPLVMGGIRKVVDSCKPSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 22,095.396 | ||
| Theoretical pI: | 8.684 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28795 | ||
| Instability index: | 37.254 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.236 | ||
| sheet | 0.200 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337790.1 | 5prime_partial | 195 | 644-57(-) |
Amino Acid sequence : | |||
| TYGDEKFVSMAEIVASDDAVKDRVHIVYGLSKDFCIPGFRVGVIYSFNDNVLKASKKLARFFSVSTPTQQILAPILSDKRFIREYINPNRQRIRSMYDLFVSGLREVGLEYTTSSGGLYC WVDMSKLISPYNEKGELDLWEKLLNIAKINVTPGSACHCIEPGWFRFCFTTLKEKEIPLVMGGIRKVVDSCKPSV* | |||
Physicochemical properties | |||
| Number of amino acids: | 195 | ||
| Molecular weight: | 22,095.396 | ||
| Theoretical pI: | 8.684 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28795 | ||
| Instability index: | 37.254 | ||
| aromaticity | 0.113 | ||
| GRAVY | -0.055 | ||
Secondary Structure Fraction | |||
| Helix | 0.359 | ||
| turn | 0.236 | ||
| sheet | 0.200 | ||