| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337805.1 | internal | 235 | 3-707(+) |
Amino Acid sequence : | |||
| TLFTALRPSPLDSLPCHNATPPPKRLPLTISAAASTVAAPPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLAGESGITLIDRFDASKFPTRFGGQIRGFKSEGYIDGKNDRRLDDCL RYCIVAGKKALEDADLGGEKLGKIDKIRAGVLVGTGMGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADLML | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,877.455 | ||
| Theoretical pI: | 11.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 115.472 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.408 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337805.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
| APFSPPSAPLLSILSPATMPHLHLRGFPSQSPQLPPPSPRRRSARPTPRSASSSPEWDSSPCSETTWMRTTRSCLPERAGSLLSTDSTPRNSPRASAARLGVSSRRGISTAKMTGDWMIA * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,877.455 | ||
| Theoretical pI: | 11.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 115.472 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.408 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337805.1 | internal | 235 | 3-707(+) |
Amino Acid sequence : | |||
| TLFTALRPSPLDSLPCHNATPPPKRLPLTISAAASTVAAPPKRETDPKKRVVITGMGLVSVFGNDVDAYYEKLLAGESGITLIDRFDASKFPTRFGGQIRGFKSEGYIDGKNDRRLDDCL RYCIVAGKKALEDADLGGEKLGKIDKIRAGVLVGTGMGGLTVFSDGVQALIEKGHRKITPFFIPYAITNMGSALLAIDLGLMGPNYSISTACATSNYCFYAAANHIRRGEADLML | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 12,877.455 | ||
| Theoretical pI: | 11.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 115.472 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.408 | ||
| sheet | 0.233 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337805.1 | 5prime_partial | 120 | 1-363(+) |
Amino Acid sequence : | |||
| APFSPPSAPLLSILSPATMPHLHLRGFPSQSPQLPPPSPRRRSARPTPRSASSSPEWDSSPCSETTWMRTTRSCLPERAGSLLSTDSTPRNSPRASAARLGVSSRRGISTAKMTGDWMIA * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 12,877.455 | ||
| Theoretical pI: | 11.748 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16500 16625 | ||
| Instability index: | 115.472 | ||
| aromaticity | 0.042 | ||
| GRAVY | -0.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.158 | ||
| turn | 0.408 | ||
| sheet | 0.233 | ||