Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337807.1 | 5prime_partial | 230 | 733-41(-) |
Amino Acid sequence : | |||
GLITCSFKSAAISSLVTVSSCCVEISTGVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYALSNIRALL LNIHQNLAVIRIKTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGNLIAELVGVPLIHRLRCKQEGLHLSSLNLRSKELRI* | |||
Physicochemical properties | |||
Number of amino acids: | 230 | ||
Molecular weight: | 21,557.056 | ||
Theoretical pI: | 4.715 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
Instability index: | 36.893 | ||
aromaticity | 0.051 | ||
GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.188 | ||
sheet | 0.254 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337807.1 | complete | 197 | 83-676(+) |
Amino Acid sequence : | |||
METFLFTSESVNEGHPDKLCDQISDAVLDACLAQDPESKVACETCTKTNMVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGA GDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGKTQVTVEYYNENGAMVPVRVHTCADLHTA* | |||
Physicochemical properties | |||
Number of amino acids: | 197 | ||
Molecular weight: | 21,557.056 | ||
Theoretical pI: | 4.715 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 11460 11960 | ||
Instability index: | 36.893 | ||
aromaticity | 0.051 | ||
GRAVY | -0.311 | ||
Secondary Structure Fraction | |||
Helix | 0.254 | ||
turn | 0.188 | ||
sheet | 0.254 |