| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337810.1 | 5prime_partial | 134 | 441-37(-) |
Amino Acid sequence : | |||
| WHEGRFLFAKYPILAAPLEPLIPVLWLYHSVPYASLVAFFGLYLGVVRNPSFSRYGRFNALQALVLDVLLVLPVLLQRIISPGRTGIGLKLTGWAYSGLFVFVVACFVYGPASRVFGRTP YLPLVAQAAGRQLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,881.484 | ||
| Theoretical pI: | 10.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 42.828 | ||
| aromaticity | 0.157 | ||
| GRAVY | 0.701 | ||
Secondary Structure Fraction | |||
| Helix | 0.478 | ||
| turn | 0.239 | ||
| sheet | 0.291 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337810.1 | 5prime_partial | 134 | 441-37(-) |
Amino Acid sequence : | |||
| WHEGRFLFAKYPILAAPLEPLIPVLWLYHSVPYASLVAFFGLYLGVVRNPSFSRYGRFNALQALVLDVLLVLPVLLQRIISPGRTGIGLKLTGWAYSGLFVFVVACFVYGPASRVFGRTP YLPLVAQAAGRQLE* | |||
Physicochemical properties | |||
| Number of amino acids: | 134 | ||
| Molecular weight: | 14,881.484 | ||
| Theoretical pI: | 10.001 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 28420 28420 | ||
| Instability index: | 42.828 | ||
| aromaticity | 0.157 | ||
| GRAVY | 0.701 | ||
Secondary Structure Fraction | |||
| Helix | 0.478 | ||
| turn | 0.239 | ||
| sheet | 0.291 | ||