Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337817.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
TLFMSISMQFISCVPLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVER ALRIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKY | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 26,548.227 | ||
Theoretical pI: | 9.110 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
Instability index: | 49.407 | ||
aromaticity | 0.095 | ||
GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.224 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337817.1 | internal | 232 | 3-698(+) |
Amino Acid sequence : | |||
TLFMSISMQFISCVPLPLPGMGLFRRRPPLSVRCSTDSSLPATVESSDFDAKVFRHNFMRRKDYNRKGFGHEEESLQRISRQYASENIIQKLRENGNEYRWGEVSVKLAEAYGLCWGVER ALRIAYEARKQFPTQNIWLTSEIIHNPTVNQRLKEMGVNILPVKDGKKQFDLVGEGDVVVLSAFGAPVDEMVLLTQKKVDVVDTTCPWVSKVWHAVEKHKKGDYTSIIHGKY | |||
Physicochemical properties | |||
Number of amino acids: | 232 | ||
Molecular weight: | 26,548.227 | ||
Theoretical pI: | 9.110 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37930 38180 | ||
Instability index: | 49.407 | ||
aromaticity | 0.095 | ||
GRAVY | -0.383 | ||
Secondary Structure Fraction | |||
Helix | 0.319 | ||
turn | 0.224 | ||
sheet | 0.220 |