| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337834.1 | 3prime_partial | 235 | 25-729(+) |
Amino Acid sequence : | |||
| MALPYPAPRHVIPMLELSQWLATGGVKVTFVNSQFNHRRVVESSPGIGEMVSMVCVSDGLEKWEDRNDLEKQSEGMLRVMAAEVEALITKINGNDGPKITCITADWTMAWAVGDATARFG LRTAIFCPASAATLALCVVIPKLVADGVIDDKDGQPLSKNQTIQLSPSTPPINSGDFVWACLGSRISVENHFYMLCKGHNSITSSYWILCNSSHDLEPGIFSSFPQLQPHRPTPR | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 11,855.357 | ||
| Theoretical pI: | 6.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.599 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.330 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337834.1 | complete | 109 | 347-18(-) |
Amino Acid sequence : | |||
| MVQSAVIHVILGPSFPFIFVIRASTSAAITLNMPSDCFSRSFLSSHFSSPSETHTILTISPIPGDDSTTRRWLNWLFTNVTFTPPVASHCESSNMGMTWRGAGYGSAIT* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,855.357 | ||
| Theoretical pI: | 6.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.599 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.330 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337834.1 | 3prime_partial | 235 | 25-729(+) |
Amino Acid sequence : | |||
| MALPYPAPRHVIPMLELSQWLATGGVKVTFVNSQFNHRRVVESSPGIGEMVSMVCVSDGLEKWEDRNDLEKQSEGMLRVMAAEVEALITKINGNDGPKITCITADWTMAWAVGDATARFG LRTAIFCPASAATLALCVVIPKLVADGVIDDKDGQPLSKNQTIQLSPSTPPINSGDFVWACLGSRISVENHFYMLCKGHNSITSSYWILCNSSHDLEPGIFSSFPQLQPHRPTPR | |||
Physicochemical properties | |||
| Number of amino acids: | 235 | ||
| Molecular weight: | 11,855.357 | ||
| Theoretical pI: | 6.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.599 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.330 | ||
| sheet | 0.174 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337834.1 | complete | 109 | 347-18(-) |
Amino Acid sequence : | |||
| MVQSAVIHVILGPSFPFIFVIRASTSAAITLNMPSDCFSRSFLSSHFSSPSETHTILTISPIPGDDSTTRRWLNWLFTNVTFTPPVASHCESSNMGMTWRGAGYGSAIT* | |||
Physicochemical properties | |||
| Number of amino acids: | 109 | ||
| Molecular weight: | 11,855.357 | ||
| Theoretical pI: | 6.888 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17990 18115 | ||
| Instability index: | 63.599 | ||
| aromaticity | 0.110 | ||
| GRAVY | 0.218 | ||
Secondary Structure Fraction | |||
| Helix | 0.303 | ||
| turn | 0.330 | ||
| sheet | 0.174 | ||