| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337835.1 | 5prime_partial | 177 | 659-126(-) |
Amino Acid sequence : | |||
| AESTCLTWLHQHPPNSVVYAAFGSYTILETTQFRELAFGLELAGRPFLWMVRRDAAGEEFFPAGFEERVGPRGKVVGWAPQQEVLAHPLVACFMSHCGWNSTIEGVSNGVPPLCWPYFAD QFCNREYVCDKWKTGLRLGKDENGIVTREEVRTKVESVVGDGGFKERASNIRASSYG* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 11,057.304 | ||
| Theoretical pI: | 11.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 82.686 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.358 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337835.1 | 5prime_partial | 106 | 660-340(-) |
Amino Acid sequence : | |||
| GGIHVPHVAPPAPAQFRSIRRLRQLHHPRNDTVSGAGLRARARRPAVSVDGPAGRRRRRIFPGGVRGEGGAAGEGGGVGPAAGGAGPPFGGVFHESLWVEFDYRRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,057.304 | ||
| Theoretical pI: | 11.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 82.686 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.358 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337835.1 | 5prime_partial | 177 | 659-126(-) |
Amino Acid sequence : | |||
| AESTCLTWLHQHPPNSVVYAAFGSYTILETTQFRELAFGLELAGRPFLWMVRRDAAGEEFFPAGFEERVGPRGKVVGWAPQQEVLAHPLVACFMSHCGWNSTIEGVSNGVPPLCWPYFAD QFCNREYVCDKWKTGLRLGKDENGIVTREEVRTKVESVVGDGGFKERASNIRASSYG* | |||
Physicochemical properties | |||
| Number of amino acids: | 177 | ||
| Molecular weight: | 11,057.304 | ||
| Theoretical pI: | 11.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 82.686 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.358 | ||
| sheet | 0.198 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337835.1 | 5prime_partial | 106 | 660-340(-) |
Amino Acid sequence : | |||
| GGIHVPHVAPPAPAQFRSIRRLRQLHHPRNDTVSGAGLRARARRPAVSVDGPAGRRRRRIFPGGVRGEGGAAGEGGGVGPAAGGAGPPFGGVFHESLWVEFDYRRG* | |||
Physicochemical properties | |||
| Number of amino acids: | 106 | ||
| Molecular weight: | 11,057.304 | ||
| Theoretical pI: | 11.950 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
| Instability index: | 82.686 | ||
| aromaticity | 0.066 | ||
| GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
| Helix | 0.217 | ||
| turn | 0.358 | ||
| sheet | 0.198 | ||