Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337835.1 | 5prime_partial | 177 | 659-126(-) |
Amino Acid sequence : | |||
AESTCLTWLHQHPPNSVVYAAFGSYTILETTQFRELAFGLELAGRPFLWMVRRDAAGEEFFPAGFEERVGPRGKVVGWAPQQEVLAHPLVACFMSHCGWNSTIEGVSNGVPPLCWPYFAD QFCNREYVCDKWKTGLRLGKDENGIVTREEVRTKVESVVGDGGFKERASNIRASSYG* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 11,057.304 | ||
Theoretical pI: | 11.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 82.686 | ||
aromaticity | 0.066 | ||
GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.358 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337835.1 | 5prime_partial | 106 | 660-340(-) |
Amino Acid sequence : | |||
GGIHVPHVAPPAPAQFRSIRRLRQLHHPRNDTVSGAGLRARARRPAVSVDGPAGRRRRRIFPGGVRGEGGAAGEGGGVGPAAGGAGPPFGGVFHESLWVEFDYRRG* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,057.304 | ||
Theoretical pI: | 11.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 82.686 | ||
aromaticity | 0.066 | ||
GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.358 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337835.1 | 5prime_partial | 177 | 659-126(-) |
Amino Acid sequence : | |||
AESTCLTWLHQHPPNSVVYAAFGSYTILETTQFRELAFGLELAGRPFLWMVRRDAAGEEFFPAGFEERVGPRGKVVGWAPQQEVLAHPLVACFMSHCGWNSTIEGVSNGVPPLCWPYFAD QFCNREYVCDKWKTGLRLGKDENGIVTREEVRTKVESVVGDGGFKERASNIRASSYG* | |||
Physicochemical properties | |||
Number of amino acids: | 177 | ||
Molecular weight: | 11,057.304 | ||
Theoretical pI: | 11.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 82.686 | ||
aromaticity | 0.066 | ||
GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.358 | ||
sheet | 0.198 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337835.1 | 5prime_partial | 106 | 660-340(-) |
Amino Acid sequence : | |||
GGIHVPHVAPPAPAQFRSIRRLRQLHHPRNDTVSGAGLRARARRPAVSVDGPAGRRRRRIFPGGVRGEGGAAGEGGGVGPAAGGAGPPFGGVFHESLWVEFDYRRG* | |||
Physicochemical properties | |||
Number of amino acids: | 106 | ||
Molecular weight: | 11,057.304 | ||
Theoretical pI: | 11.950 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 6990 6990 | ||
Instability index: | 82.686 | ||
aromaticity | 0.066 | ||
GRAVY | -0.529 | ||
Secondary Structure Fraction | |||
Helix | 0.217 | ||
turn | 0.358 | ||
sheet | 0.198 |