| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337841.1 | 5prime_partial | 145 | 1-438(+) |
Amino Acid sequence : | |||
| PLILLMNGSQPDQTPSDIIPSQQLNEILQKREVGHHIVMAEAPTHHNNVDENDNQSNVVRKVPMRVSIYRGHPMQRRVNHCTQPGKLIAAPNSLPELKSIAGQKFGFDTTNTLVTNEEGA MIDSIELIRDNDKLFIVESEYFISP* | |||
Physicochemical properties | |||
| Number of amino acids: | 145 | ||
| Molecular weight: | 16,291.269 | ||
| Theoretical pI: | 5.625 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 2980 | ||
| Instability index: | 44.112 | ||
| aromaticity | 0.041 | ||
| GRAVY | -0.484 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.276 | ||
| sheet | 0.221 | ||