Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337857.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
KQNGWTDSXNLDVDSDSRLELFDGFFTSLSMILVSEIGDETFIIAALMAMRHPKSIVLSGALSALFVMTILSTGLGRIVPNLISRKHTNSAATVLYAFFGLRLLYIAWKSDPKGSQKKEI EEVEEKLEAGQGKSTWRRFFSRFCTPIYLESFILTFLAEWGDRSQIATIALATHKNAVGVAAGATIGHTICTSVAVIGGSMLALEDFATFGC | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 23,009.275 | ||
Theoretical pI: | 6.109 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 37.368 | ||
aromaticity | 0.100 | ||
GRAVY | 0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.218 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337857.1 | internal | 212 | 1-636(+) |
Amino Acid sequence : | |||
KQNGWTDSXNLDVDSDSRLELFDGFFTSLSMILVSEIGDETFIIAALMAMRHPKSIVLSGALSALFVMTILSTGLGRIVPNLISRKHTNSAATVLYAFFGLRLLYIAWKSDPKGSQKKEI EEVEEKLEAGQGKSTWRRFFSRFCTPIYLESFILTFLAEWGDRSQIATIALATHKNAVGVAAGATIGHTICTSVAVIGGSMLALEDFATFGC | |||
Physicochemical properties | |||
Number of amino acids: | 212 | ||
Molecular weight: | 23,009.275 | ||
Theoretical pI: | 6.109 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
Instability index: | 37.368 | ||
aromaticity | 0.100 | ||
GRAVY | 0.279 | ||
Secondary Structure Fraction | |||
Helix | 0.341 | ||
turn | 0.218 | ||
sheet | 0.289 |