Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337879.1 | 5prime_partial | 173 | 3-524(+) |
Amino Acid sequence : | |||
TPLIGALAVALKQAFLPGFKAYAKQVKANAVALGNYLMNKGYSLVTGGTENHLVLWDLQPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLVGKDFEQIAEFL HRAVSLTLKIQKEHGKLLKDFNKGLVNNKQIEELKADVEKFPASFDMPGFLVS* | |||
Physicochemical properties | |||
Number of amino acids: | 173 | ||
Molecular weight: | 18,568.426 | ||
Theoretical pI: | 9.206 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
Instability index: | 36.302 | ||
aromaticity | 0.075 | ||
GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
Helix | 0.329 | ||
turn | 0.243 | ||
sheet | 0.306 |