| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337879.1 | 5prime_partial | 173 | 3-524(+) |
Amino Acid sequence : | |||
| TPLIGALAVALKQAFLPGFKAYAKQVKANAVALGNYLMNKGYSLVTGGTENHLVLWDLQPLGLTGNKVEKLCDLCNITVNKNAVFGDSSALAPGGVRIGAPAMTSRGLVGKDFEQIAEFL HRAVSLTLKIQKEHGKLLKDFNKGLVNNKQIEELKADVEKFPASFDMPGFLVS* | |||
Physicochemical properties | |||
| Number of amino acids: | 173 | ||
| Molecular weight: | 18,568.426 | ||
| Theoretical pI: | 9.206 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 9970 10095 | ||
| Instability index: | 36.302 | ||
| aromaticity | 0.075 | ||
| GRAVY | 0.061 | ||
Secondary Structure Fraction | |||
| Helix | 0.329 | ||
| turn | 0.243 | ||
| sheet | 0.306 | ||