Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337893.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
NRMHEWIADNPLACGGTYQTCILAVPFLARKQGLVTVTCDPRNLEHILKGRFDNYPKGPTWQAVFHDLLGDGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSRAIKNRFCPILEMA QLEGKPVDLQDLLLRITFDNICGLAFGKDPQTLSSGLPENSFAMAFDRATEASLQRFILPEFIWKSKKWLRLGMELSLSRSLKHVDDYLTNVINIRKLELLSQQQDSGSQHDDLLSRFMK | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 27,476.336 | ||
Theoretical pI: | 8.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37720 | ||
Instability index: | 46.963 | ||
aromaticity | 0.096 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.200 | ||
sheet | 0.271 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337893.1 | internal | 240 | 2-721(+) |
Amino Acid sequence : | |||
NRMHEWIADNPLACGGTYQTCILAVPFLARKQGLVTVTCDPRNLEHILKGRFDNYPKGPTWQAVFHDLLGDGIFNSDGDTWLFQRKTAALEFTTRTLRQAMARWVSRAIKNRFCPILEMA QLEGKPVDLQDLLLRITFDNICGLAFGKDPQTLSSGLPENSFAMAFDRATEASLQRFILPEFIWKSKKWLRLGMELSLSRSLKHVDDYLTNVINIRKLELLSQQQDSGSQHDDLLSRFMK | |||
Physicochemical properties | |||
Number of amino acids: | 240 | ||
Molecular weight: | 27,476.336 | ||
Theoretical pI: | 8.611 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 37470 37720 | ||
Instability index: | 46.963 | ||
aromaticity | 0.096 | ||
GRAVY | -0.272 | ||
Secondary Structure Fraction | |||
Helix | 0.317 | ||
turn | 0.200 | ||
sheet | 0.271 |