| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337895.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
| RFLTSNPALLAQPMPLQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRHSLPD | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 26,320.377 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.021 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.280 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337895.1 | 5prime_partial | 254 | 789-25(-) |
Amino Acid sequence : | |||
| IRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVHDEIGAA ARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAA RGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 26,320.377 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.021 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.280 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337895.1 | internal | 263 | 1-789(+) |
Amino Acid sequence : | |||
| RFLTSNPALLAQPMPLQVEKTTSGREYKVKDMSQADFGRLEIELAEVEMPGLISCRTEFGPSQPFKGARITGSLHMTIQTAVLIETLTALGAEVRWCSCNIFSTQDHAAAAIARDSAAVF AWKGETLQEYWWCTERALDWGPGGGPDLIVDDGGDATLLIHEGVKAEEEYEKSGKLPDPSSTDNAEFQIVLTLIRDGLKANPTKYRKMKERLVGVSEETTTGVKRLYQMQANGTLLFPAI NVNDSVTKSKFDNLYGCRHSLPD | |||
Physicochemical properties | |||
| Number of amino acids: | 263 | ||
| Molecular weight: | 26,320.377 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.021 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.280 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337895.1 | 5prime_partial | 254 | 789-25(-) |
Amino Acid sequence : | |||
| IRQRVAASVQVIELALGDGIIDIDGREKQSAISLHLIQPLHTSSCFLRNTNQSLLHLPVLGGIGLQPISDQRQHYLKLRIIGRAGVRQLPTFLVLLLRLDALVNQQRGITAVVHDEIGAA ARPPIEGPLGAPPVLLQGFALPGEDGGAVASNGSGGVVLSGEDVARAPSDLSAESGEGLDEDGSLDGHVETSGDAGTLEGLGGTELGPAGNEARHLHLGELDFEAAEVGLGHVLDLVLAA RGGLLNLERHGLSE* | |||
Physicochemical properties | |||
| Number of amino acids: | 254 | ||
| Molecular weight: | 26,320.377 | ||
| Theoretical pI: | 4.915 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 41.021 | ||
| aromaticity | 0.020 | ||
| GRAVY | 0.064 | ||
Secondary Structure Fraction | |||
| Helix | 0.311 | ||
| turn | 0.280 | ||
| sheet | 0.331 | ||