| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337901.1 | complete | 160 | 191-673(+) |
Amino Acid sequence : | |||
| MGRGKFKGKPTGRRHFSTPEEMMAGSSARPRTFKKAEAEAEEDEISDVESEEESDDEPEKTKGTQGVIQIENPNLAKPKNLKPRDVDVEKTTELSRREREEIEKQKAHERYMRLQEQGKT EQARKDLERLALIRQQRAEAAKKRDEEKAAKEQKKAEARK* | |||
Physicochemical properties | |||
| Number of amino acids: | 160 | ||
| Molecular weight: | 18,503.447 | ||
| Theoretical pI: | 8.666 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 1490 1490 | ||
| Instability index: | 56.798 | ||
| aromaticity | 0.025 | ||
| GRAVY | -1.603 | ||
Secondary Structure Fraction | |||
| Helix | 0.125 | ||
| turn | 0.156 | ||
| sheet | 0.350 | ||