Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337903.1 | 3prime_partial | 221 | 113-775(+) |
Amino Acid sequence : | |||
MPLSIGQCGECSNCATGKTNICFKYPFGISGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSA SRILGASKIIGIDVNELKREKATVFGVTEFINPKHSDKTVSQLIQEATGGLGVDCCIECTGVSSLLNEAIASTKVGIGEVVLIGAGEKEKVEISYIPPYVG | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 10,740.137 | ||
Theoretical pI: | 6.015 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 63.887 | ||
aromaticity | 0.060 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.310 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337903.1 | complete | 100 | 681-379(-) |
Amino Acid sequence : | |||
MASLRREETPVHSMQQSTPNPPVASWISCDTVLSECLGFMNSVTPKTVAFSRLSSFTSIPIIFDAPRIRDALTAPSPTAPRPITATVDPFSTLDSLHGAP* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,740.137 | ||
Theoretical pI: | 6.015 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 63.887 | ||
aromaticity | 0.060 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.310 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337903.1 | 3prime_partial | 221 | 113-775(+) |
Amino Acid sequence : | |||
MPLSIGQCGECSNCATGKTNICFKYPFGISGLMPDGTSRMSAKGQKLYHMFTCSTWSEYTVVDSNFVVKVDPRIPLPHASLLTCGFLTGYGAPWRESRVEKGSTVAVIGLGAVGLGAVSA SRILGASKIIGIDVNELKREKATVFGVTEFINPKHSDKTVSQLIQEATGGLGVDCCIECTGVSSLLNEAIASTKVGIGEVVLIGAGEKEKVEISYIPPYVG | |||
Physicochemical properties | |||
Number of amino acids: | 221 | ||
Molecular weight: | 10,740.137 | ||
Theoretical pI: | 6.015 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 63.887 | ||
aromaticity | 0.060 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.310 | ||
sheet | 0.220 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337903.1 | complete | 100 | 681-379(-) |
Amino Acid sequence : | |||
MASLRREETPVHSMQQSTPNPPVASWISCDTVLSECLGFMNSVTPKTVAFSRLSSFTSIPIIFDAPRIRDALTAPSPTAPRPITATVDPFSTLDSLHGAP* | |||
Physicochemical properties | |||
Number of amino acids: | 100 | ||
Molecular weight: | 10,740.137 | ||
Theoretical pI: | 6.015 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 5500 5625 | ||
Instability index: | 63.887 | ||
aromaticity | 0.060 | ||
GRAVY | -0.010 | ||
Secondary Structure Fraction | |||
Helix | 0.250 | ||
turn | 0.310 | ||
sheet | 0.220 |