Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337906.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
TPIAHTHTHSLSDPSPDAEMAYSGAIRSSFLPLLDSDEFGSLSRSTAALPIRNQKFCVGAVLHQDGANDVVAGEISTARKPRALSFSGEKPATPILDTINYPNHMKNLSVEEVDRLGDEL REEIVYPASKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPH* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 12,539.449 | ||
Theoretical pI: | 9.234 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 86.465 | ||
aromaticity | 0.070 | ||
GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.307 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337906.1 | complete | 153 | 497-36(-) |
Amino Acid sequence : | |||
MSDIPNDFIIRRVEHVMKRHSELRNAQARTQMPSRFRRRVHNLLPQFIPQPIHFLHAQILHVIRIVDRIQNRRRRLLPRETQRSRFPRRRNLPRNDVVRSVLVKHRPHTKLLISDRKSGG GSRKRAEFVGIEEWEETASDSSGIRHFCVGRWI* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 12,539.449 | ||
Theoretical pI: | 9.234 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 86.465 | ||
aromaticity | 0.070 | ||
GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.307 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337906.1 | 5prime_partial | 114 | 2-346(+) |
Amino Acid sequence : | |||
HADSTHTHTLTLRSIARRRNGVFRSYQKQFPPTPRFRRIRLAFSIHRRSSDQKSKVLCGGGASPGRSERRRCGGDFDGAETESAEFLGGEAGDADSGYDQLSESHEESERGGSG* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,539.449 | ||
Theoretical pI: | 9.234 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 86.465 | ||
aromaticity | 0.070 | ||
GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.307 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337906.1 | 5prime_partial | 170 | 3-515(+) |
Amino Acid sequence : | |||
TPIAHTHTHSLSDPSPDAEMAYSGAIRSSFLPLLDSDEFGSLSRSTAALPIRNQKFCVGAVLHQDGANDVVAGEISTARKPRALSFSGEKPATPILDTINYPNHMKNLSVEEVDRLGDEL REEIVYPASKTGGHLSSSLGVSELTVALHHVFNTPDDKIIWDVGHQAYPH* | |||
Physicochemical properties | |||
Number of amino acids: | 170 | ||
Molecular weight: | 12,539.449 | ||
Theoretical pI: | 9.234 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 86.465 | ||
aromaticity | 0.070 | ||
GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.307 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337906.1 | complete | 153 | 497-36(-) |
Amino Acid sequence : | |||
MSDIPNDFIIRRVEHVMKRHSELRNAQARTQMPSRFRRRVHNLLPQFIPQPIHFLHAQILHVIRIVDRIQNRRRRLLPRETQRSRFPRRRNLPRNDVVRSVLVKHRPHTKLLISDRKSGG GSRKRAEFVGIEEWEETASDSSGIRHFCVGRWI* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 12,539.449 | ||
Theoretical pI: | 9.234 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 86.465 | ||
aromaticity | 0.070 | ||
GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.307 | ||
sheet | 0.202 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337906.1 | 5prime_partial | 114 | 2-346(+) |
Amino Acid sequence : | |||
HADSTHTHTLTLRSIARRRNGVFRSYQKQFPPTPRFRRIRLAFSIHRRSSDQKSKVLCGGGASPGRSERRRCGGDFDGAETESAEFLGGEAGDADSGYDQLSESHEESERGGSG* | |||
Physicochemical properties | |||
Number of amino acids: | 114 | ||
Molecular weight: | 12,539.449 | ||
Theoretical pI: | 9.234 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 2980 3105 | ||
Instability index: | 86.465 | ||
aromaticity | 0.070 | ||
GRAVY | -1.083 | ||
Secondary Structure Fraction | |||
Helix | 0.167 | ||
turn | 0.307 | ||
sheet | 0.202 |