| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337913.1 | 5prime_partial | 257 | 1-774(+) |
Amino Acid sequence : | |||
| RSAAIPLHLRFTTAVAATSTMGEIAADSAMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRESELI EENALGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRMLYKAPSDGIWGEHELDYLLFIVRDVEVHPNPDEVADVKYVNREELKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKG TLNEAVDMKTIHRLLEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 29,562.426 | ||
| Theoretical pI: | 5.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 29.414 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.167 | ||
| sheet | 0.331 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337913.1 | 5prime_partial | 257 | 1-774(+) |
Amino Acid sequence : | |||
| RSAAIPLHLRFTTAVAATSTMGEIAADSAMDAVQRRLMFEDECILVDENDHVVGHESKYNCHLMEKIESLNLLHRAFSVFLFNSKYELLLQQRSTTKVTFPLVWTNTCCSHPLYRESELI EENALGVRNAAQRKLLDELGIPAEDVPVDQFTPLGRMLYKAPSDGIWGEHELDYLLFIVRDVEVHPNPDEVADVKYVNREELKELLRKADAGEEGLKLSPWFRLVVDNFLFKWWDHVEKG TLNEAVDMKTIHRLLEK* | |||
Physicochemical properties | |||
| Number of amino acids: | 257 | ||
| Molecular weight: | 29,562.426 | ||
| Theoretical pI: | 5.173 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 36440 36690 | ||
| Instability index: | 29.414 | ||
| aromaticity | 0.086 | ||
| GRAVY | -0.259 | ||
Secondary Structure Fraction | |||
| Helix | 0.335 | ||
| turn | 0.167 | ||
| sheet | 0.331 | ||