| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337918.1 | 3prime_partial | 159 | 85-561(+) |
Amino Acid sequence : | |||
| MTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAPLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAM SCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMAKAI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,976.481 | ||
| Theoretical pI: | 7.757 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 40.927 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.226 | ||
| sheet | 0.277 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337918.1 | 3prime_partial | 159 | 85-561(+) |
Amino Acid sequence : | |||
| MTLSQLLKAIPINKEKSQSFQRLMRALVNSNFFIEENSNNQEVCYWLTPASRLLLKGAPLTVAPLVQVVLDPTFTNPWHYMSEWFKHENHATQFEAANGCTFWEKLANKPSMGRFFDEAM SCDSRLVAHVLTKDYKHVIDGIRTLVDVGGGNGTMAKAI | |||
Physicochemical properties | |||
| Number of amino acids: | 159 | ||
| Molecular weight: | 17,976.481 | ||
| Theoretical pI: | 7.757 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 26470 26595 | ||
| Instability index: | 40.927 | ||
| aromaticity | 0.101 | ||
| GRAVY | -0.185 | ||
Secondary Structure Fraction | |||
| Helix | 0.308 | ||
| turn | 0.226 | ||
| sheet | 0.277 | ||