Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337920.1 | 5prime_partial | 135 | 3-410(+) |
Amino Acid sequence : | |||
LILDLPHVVAGLETTDKLSYIGGDMFQSIPSADAILLKFIIHDWDDEEGLKILKRCKDAVGIGGKVIIIDVVVGVNHDVDEVLEDQLHFDMAMMCYFNAKERTMNEWEKLISDAGFTSYK LTPAFGVRSLIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 135 | ||
Molecular weight: | 15,103.272 | ||
Theoretical pI: | 4.576 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
Instability index: | 27.765 | ||
aromaticity | 0.089 | ||
GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
Helix | 0.370 | ||
turn | 0.170 | ||
sheet | 0.274 |