| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337920.1 | 5prime_partial | 135 | 3-410(+) |
Amino Acid sequence : | |||
| LILDLPHVVAGLETTDKLSYIGGDMFQSIPSADAILLKFIIHDWDDEEGLKILKRCKDAVGIGGKVIIIDVVVGVNHDVDEVLEDQLHFDMAMMCYFNAKERTMNEWEKLISDAGFTSYK LTPAFGVRSLIEAYP* | |||
Physicochemical properties | |||
| Number of amino acids: | 135 | ||
| Molecular weight: | 15,103.272 | ||
| Theoretical pI: | 4.576 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 16960 17085 | ||
| Instability index: | 27.765 | ||
| aromaticity | 0.089 | ||
| GRAVY | 0.150 | ||
Secondary Structure Fraction | |||
| Helix | 0.370 | ||
| turn | 0.170 | ||
| sheet | 0.274 | ||