| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337927.1 | 5prime_partial | 164 | 745-251(-) |
Amino Acid sequence : | |||
| ALQEALPGDNVGFNVKNVAVKDLKRGYVASNSKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHPSHIAVKFAELLTKIDRRSGKELEKEPKFLKNGDAGMIKMIPTKPMVVETFSA YPPLGRFAVRDMRQTVAVGVIKSVEKKDPTGAKVTKAAAKKGAK* | |||
Physicochemical properties | |||
| Number of amino acids: | 164 | ||
| Molecular weight: | 16,495.969 | ||
| Theoretical pI: | 8.988 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 34.136 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.265 | ||
| sheet | 0.265 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337927.1 | complete | 151 | 203-658(+) |
Amino Acid sequence : | |||
| MSMVIVLQNTKTPFTYSLGPLLRRSLGHLGSRRVLLLHALDHSNSHRLTHVPHGKPPERWVGREGLHHHGLCRNHLNHTCITVLQELGLLLELLTRTTINLGEKLGKLDCNVGGVAVEDW GISISNLAGVVHDDDLGSKVGSLLGRVILGV* | |||
Physicochemical properties | |||
| Number of amino acids: | 151 | ||
| Molecular weight: | 16,495.969 | ||
| Theoretical pI: | 8.988 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12490 12615 | ||
| Instability index: | 34.136 | ||
| aromaticity | 0.026 | ||
| GRAVY | 0.043 | ||
Secondary Structure Fraction | |||
| Helix | 0.351 | ||
| turn | 0.265 | ||
| sheet | 0.265 | ||