Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337944.1 | 5prime_partial | 241 | 2-727(+) |
Amino Acid sequence : | |||
HAVKMCVVSLVILLSIITISPLAHAQLPINVGPIVRPILGPLLGPILGQPAPPIVPPVGQVPPVRVGQLPILGPILGPILGPILGPILGQPIVPPTNTPPILPPIVPPVGQVPPIVPPIV PPVINLTILGSLSCSVPGSNAPGPGVSGANVTIICGNTTIAQVSTNSQGIINAAVSTNTSLLSGTCIARIPLPIANCTLTPTTGALVAPVILIGNLVQNMVGQTLTAILGILTSLATVTI T* | |||
Physicochemical properties | |||
Number of amino acids: | 241 | ||
Molecular weight: | 23,997.679 | ||
Theoretical pI: | 9.140 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 41.912 | ||
aromaticity | 0.000 | ||
GRAVY | 0.944 | ||
Secondary Structure Fraction | |||
Helix | 0.382 | ||
turn | 0.373 | ||
sheet | 0.195 |