Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337949.1 | 5prime_partial | 178 | 1-537(+) |
Amino Acid sequence : | |||
ARRKNTHTNTHKTQKMSLITDEIRAAASEMYRGDEICQEKSRFLLTEMNLPNGLLPLKDMVECGYVKETGFVWLIQKKKCEHKFEKIGRSVQYATEVTAVVEPGRIKKLTGVKAKEMLMW LTLSDIYLDDPPTGKITFKSPTGLSRTFPVDAFVVEVEEKKPAAGEVKPVPAVEVKEV* | |||
Physicochemical properties | |||
Number of amino acids: | 178 | ||
Molecular weight: | 13,475.449 | ||
Theoretical pI: | 9.785 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 52.526 | ||
aromaticity | 0.000 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.138 | ||
turn | 0.293 | ||
sheet | 0.154 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337949.1 | 5prime_partial | 123 | 3-374(+) |
Amino Acid sequence : | |||
TPQKHTHKHTQNTKNVSDHRRDPGGGVGDVPRGRNLSGEIEISPDRNEPPQRPSPIKGHGGVRLRERDRLRVVDPEEEVRAQVRKNRAVGAVRDGGDGGGGAGEDQEAHRRQGQRDADVA HTQ* | |||
Physicochemical properties | |||
Number of amino acids: | 123 | ||
Molecular weight: | 13,475.449 | ||
Theoretical pI: | 9.785 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 0 | ||
Instability index: | 52.526 | ||
aromaticity | 0.000 | ||
GRAVY | -1.488 | ||
Secondary Structure Fraction | |||
Helix | 0.138 | ||
turn | 0.293 | ||
sheet | 0.154 |