Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337953.1 | 5prime_partial | 194 | 829-245(-) |
Amino Acid sequence : | |||
HMKAFTNAMIAHARLTAAAIVSNYPAAFDGLRSVVDVGGRHGTAIGRLVEAFPWVRGIAFDLPEIVADAPPRKGVDFVGGDMFESVPKADAVMLMWILHDWSDDKCIEILKKCKEAIPAS TGKVMIVDAIINEDGEGDEFSGARLSLDMIMLAVMAQGKERTYKEWVHLLNEAGFSKHTVKNIKSIESVIEAYP* | |||
Physicochemical properties | |||
Number of amino acids: | 194 | ||
Molecular weight: | 18,462.805 | ||
Theoretical pI: | 11.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 90.803 | ||
aromaticity | 0.124 | ||
GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.222 | ||
sheet | 0.137 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337953.1 | complete | 153 | 326-787(+) |
Amino Acid sequence : | |||
MHPFLISSLLSLRHHRQHYHIQRQTSTRKLVAFSIFVNYSIYNHHFSGTRWNRFFAFLQNFYAFIVAPVMQYPHEHDRVGFRHAFKHVPSDEVDPFTRRSIRHNLRQIKRNSPHPRKRLH QSPDSRSVAAAHIHHRSQSVKRRRIVAYNGSRR* | |||
Physicochemical properties | |||
Number of amino acids: | 153 | ||
Molecular weight: | 18,462.805 | ||
Theoretical pI: | 11.853 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 14440 14440 | ||
Instability index: | 90.803 | ||
aromaticity | 0.124 | ||
GRAVY | -0.773 | ||
Secondary Structure Fraction | |||
Helix | 0.301 | ||
turn | 0.222 | ||
sheet | 0.137 |