Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337956.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
KTGKDDXNVGTLRPTLFDVFGEDSSPKVKKFMNFIFGKLQGHGQGGEGGGGGFLGMVSGLAQQFLEQKLNDDSYAKPALETPLGSKQEAYAGSAKKGLPDSGILISGCQTDQTSADATPQ GDASKSYGALSNAIHTIIAESDGRVSNKELVTKARQLLKKQGFTQRPGLYCSDYHVDAPFVC* | |||
Physicochemical properties | |||
Number of amino acids: | 182 | ||
Molecular weight: | 19,123.190 | ||
Theoretical pI: | 7.004 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
Instability index: | 33.621 | ||
aromaticity | 0.077 | ||
GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
Helix | 0.243 | ||
turn | 0.293 | ||
sheet | 0.215 |