| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337956.1 | 5prime_partial | 182 | 1-549(+) |
Amino Acid sequence : | |||
| KTGKDDXNVGTLRPTLFDVFGEDSSPKVKKFMNFIFGKLQGHGQGGEGGGGGFLGMVSGLAQQFLEQKLNDDSYAKPALETPLGSKQEAYAGSAKKGLPDSGILISGCQTDQTSADATPQ GDASKSYGALSNAIHTIIAESDGRVSNKELVTKARQLLKKQGFTQRPGLYCSDYHVDAPFVC* | |||
Physicochemical properties | |||
| Number of amino acids: | 182 | ||
| Molecular weight: | 19,123.190 | ||
| Theoretical pI: | 7.004 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 7450 7575 | ||
| Instability index: | 33.621 | ||
| aromaticity | 0.077 | ||
| GRAVY | -0.468 | ||
Secondary Structure Fraction | |||
| Helix | 0.243 | ||
| turn | 0.293 | ||
| sheet | 0.215 | ||