Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337957.1 | internal | 196 | 589-2(-) |
Amino Acid sequence : | |||
DGDDAILAASTSIISLQTIVSRETDPFDSQVVSVTIVNAGDLLPNSVTIAGTFRAFGRDAFYSLGKRIQQVIKGQAAVLGCWGEVEFEGKEHPNLPPTINDEKIYQHAEQVSKMMVGEDN TILCPTFMGSEDFAVYLEKAAGSFSLLGVGTEYPPHSPYYTIDQTVLPIGASIHATFALSYLLTLRSPLPIIILRY | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,285.956 | ||
Theoretical pI: | 4.684 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 39.345 | ||
aromaticity | 0.092 | ||
GRAVY | 0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.245 | ||
sheet | 0.245 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337957.1 | internal | 196 | 589-2(-) |
Amino Acid sequence : | |||
DGDDAILAASTSIISLQTIVSRETDPFDSQVVSVTIVNAGDLLPNSVTIAGTFRAFGRDAFYSLGKRIQQVIKGQAAVLGCWGEVEFEGKEHPNLPPTINDEKIYQHAEQVSKMMVGEDN TILCPTFMGSEDFAVYLEKAAGSFSLLGVGTEYPPHSPYYTIDQTVLPIGASIHATFALSYLLTLRSPLPIIILRY | |||
Physicochemical properties | |||
Number of amino acids: | 196 | ||
Molecular weight: | 21,285.956 | ||
Theoretical pI: | 4.684 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 17420 17545 | ||
Instability index: | 39.345 | ||
aromaticity | 0.092 | ||
GRAVY | 0.120 | ||
Secondary Structure Fraction | |||
Helix | 0.342 | ||
turn | 0.245 | ||
sheet | 0.245 |