Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337958.1 | complete | 134 | 70-474(+) |
Amino Acid sequence : | |||
MAAASSSTITLPFTANPSKKCTSFSSSSSVFFSHNIKNRAGLGLCVDRPVRAQKRGFSCNCLFGLGVPELVVIVGVSALVFGPKQLPEVGRSIGKTVKSFQQAAKEFETELRKDAEPSAV AVKAADEEQQQESA* | |||
Physicochemical properties | |||
Number of amino acids: | 134 | ||
Molecular weight: | 14,209.053 | ||
Theoretical pI: | 9.022 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 250 | ||
Instability index: | 60.215 | ||
aromaticity | 0.067 | ||
GRAVY | -0.085 | ||
Secondary Structure Fraction | |||
Helix | 0.261 | ||
turn | 0.276 | ||
sheet | 0.254 |