Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337970.1 | complete | 213 | 680-39(-) |
Amino Acid sequence : | |||
MLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYTLSNIRALLLNIH QNLAVIRIKTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGDLIAELVGVPLIHRLRCNRKVSI* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 21,110.688 | ||
Theoretical pI: | 5.106 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 27.304 | ||
aromaticity | 0.058 | ||
GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.189 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337970.1 | 3prime_partial | 190 | 189-758(+) |
Amino Acid sequence : | |||
MVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGK TQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFV | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,110.688 | ||
Theoretical pI: | 5.106 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 27.304 | ||
aromaticity | 0.058 | ||
GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.189 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337970.1 | complete | 213 | 680-39(-) |
Amino Acid sequence : | |||
MLLQIRSNLIICHSLVVLCGDQHSVDADRNHRTVLVVVLDGHLSLAVRPQPRARPVFPDLSETGAELRGKNMAQRHQLRGFIRGVAKHVALITSTDFLRAFGEVAMYTLSNIRALLLNIH QNLAVIRIKTYIIGDKSNGTACVTDNLLVVDISLGGYFSKHHDHVGFGAGLTSNLALRVLSKAGVQHCIGDLIAELVGVPLIHRLRCNRKVSI* | |||
Physicochemical properties | |||
Number of amino acids: | 213 | ||
Molecular weight: | 21,110.688 | ||
Theoretical pI: | 5.106 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 27.304 | ||
aromaticity | 0.058 | ||
GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.189 | ||
sheet | 0.232 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337970.1 | 3prime_partial | 190 | 189-758(+) |
Amino Acid sequence : | |||
MVMVFGEITTKADVDYEKIVRDTCRAIGFVSDDVGLDADNCKVLVNIEQQSPDIAQGVHGHLTKRPEEIGAGDQGHMFGYATDETPELMPLSHVLATKLGARLTEVRKNGTCPWLRPDGK TQVTVEYYNENGAMVPVRVHTVLISTQHDETVTNDEIAADLKEHVIKPVIPEKYLDEKTIFHLNPSGRFV | |||
Physicochemical properties | |||
Number of amino acids: | 190 | ||
Molecular weight: | 21,110.688 | ||
Theoretical pI: | 5.106 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 12950 13075 | ||
Instability index: | 27.304 | ||
aromaticity | 0.058 | ||
GRAVY | -0.323 | ||
Secondary Structure Fraction | |||
Helix | 0.295 | ||
turn | 0.189 | ||
sheet | 0.232 |