Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337981.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
VTFLSCASTFPLAMKVIAAYLLVVLGGNTSPTPEDLKGILGSVGADADDERIELLLSQVKGKDITELIAAGREKLASVPAGGGAVAVAAPAGGAGGGAAPAAAETKKEEKVEEQEESDDD MGLGLFD* | |||
Physicochemical properties | |||
Number of amino acids: | 127 | ||
Molecular weight: | 12,685.454 | ||
Theoretical pI: | 10.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 77.530 | ||
aromaticity | 0.057 | ||
GRAVY | -0.975 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.200 | ||
sheet | 0.171 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY337981.1 | 5prime_partial | 105 | 508-191(-) |
Amino Acid sequence : | |||
ETKIKEHYIFIVLNLIQNSRCKNIRAKISNKINWKYDGVAMFSRRDPSPCHHQTPLVLRLSLLSLSRPQQVQHRHLHHQQEQQQQLHRHQQEPKLIFPSQRRSTR* | |||
Physicochemical properties | |||
Number of amino acids: | 105 | ||
Molecular weight: | 12,685.454 | ||
Theoretical pI: | 10.958 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
Instability index: | 77.530 | ||
aromaticity | 0.057 | ||
GRAVY | -0.975 | ||
Secondary Structure Fraction | |||
Helix | 0.276 | ||
turn | 0.200 | ||
sheet | 0.171 |