| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337981.1 | 5prime_partial | 127 | 1-384(+) |
Amino Acid sequence : | |||
| VTFLSCASTFPLAMKVIAAYLLVVLGGNTSPTPEDLKGILGSVGADADDERIELLLSQVKGKDITELIAAGREKLASVPAGGGAVAVAAPAGGAGGGAAPAAAETKKEEKVEEQEESDDD MGLGLFD* | |||
Physicochemical properties | |||
| Number of amino acids: | 127 | ||
| Molecular weight: | 12,685.454 | ||
| Theoretical pI: | 10.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 77.530 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.975 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.200 | ||
| sheet | 0.171 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY337981.1 | 5prime_partial | 105 | 508-191(-) |
Amino Acid sequence : | |||
| ETKIKEHYIFIVLNLIQNSRCKNIRAKISNKINWKYDGVAMFSRRDPSPCHHQTPLVLRLSLLSLSRPQQVQHRHLHHQQEQQQQLHRHQQEPKLIFPSQRRSTR* | |||
Physicochemical properties | |||
| Number of amino acids: | 105 | ||
| Molecular weight: | 12,685.454 | ||
| Theoretical pI: | 10.958 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 8480 8605 | ||
| Instability index: | 77.530 | ||
| aromaticity | 0.057 | ||
| GRAVY | -0.975 | ||
Secondary Structure Fraction | |||
| Helix | 0.276 | ||
| turn | 0.200 | ||
| sheet | 0.171 | ||