| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338007.1 | internal | 231 | 2-694(+) |
Amino Acid sequence : | |||
| HPYKCEGHVEVVALLLKRMANIDARDRWGSTAAADAKYYGNMDVYNILKARGANVPKSNKTPMTVTNPREVPEYELNPSDIQIRKSDGIYKGSYQIAKWNGTKVSVKILDKDGYADHESI NAFRHELTLLEKVRHPNVVQFIGAVTQNIPMMIVLEYNSKGDLASYLHKKGRLSASKALKLALEIARGMSCLHECKPEPIIHCDLKPKNILLDYGGKLKVSRFGVIQMVGA | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 14,394.782 | ||
| Theoretical pI: | 9.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 66.418 | ||
| aromaticity | 0.144 | ||
| GRAVY | 0.528 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.248 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338007.1 | 3prime_partial | 125 | 376-2(-) |
Amino Acid sequence : | |||
| MPECIYGFMVCIAVLVKYLHRNFSAIPFSNLIRTLIYAITFSYLNVRWIELIFWNFARIRNCHGCFIGFRNVSPASFQYVVNIHISIIFGISSSRAAPSISSVNIGHPLQEKRDDLHVPL TFIRV | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,394.782 | ||
| Theoretical pI: | 9.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 66.418 | ||
| aromaticity | 0.144 | ||
| GRAVY | 0.528 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.248 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338007.1 | internal | 231 | 2-694(+) |
Amino Acid sequence : | |||
| HPYKCEGHVEVVALLLKRMANIDARDRWGSTAAADAKYYGNMDVYNILKARGANVPKSNKTPMTVTNPREVPEYELNPSDIQIRKSDGIYKGSYQIAKWNGTKVSVKILDKDGYADHESI NAFRHELTLLEKVRHPNVVQFIGAVTQNIPMMIVLEYNSKGDLASYLHKKGRLSASKALKLALEIARGMSCLHECKPEPIIHCDLKPKNILLDYGGKLKVSRFGVIQMVGA | |||
Physicochemical properties | |||
| Number of amino acids: | 231 | ||
| Molecular weight: | 14,394.782 | ||
| Theoretical pI: | 9.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 66.418 | ||
| aromaticity | 0.144 | ||
| GRAVY | 0.528 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.248 | ||
| sheet | 0.168 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338007.1 | 3prime_partial | 125 | 376-2(-) |
Amino Acid sequence : | |||
| MPECIYGFMVCIAVLVKYLHRNFSAIPFSNLIRTLIYAITFSYLNVRWIELIFWNFARIRNCHGCFIGFRNVSPASFQYVVNIHISIIFGISSSRAAPSISSVNIGHPLQEKRDDLHVPL TFIRV | |||
Physicochemical properties | |||
| Number of amino acids: | 125 | ||
| Molecular weight: | 14,394.782 | ||
| Theoretical pI: | 9.554 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 18450 18700 | ||
| Instability index: | 66.418 | ||
| aromaticity | 0.144 | ||
| GRAVY | 0.528 | ||
Secondary Structure Fraction | |||
| Helix | 0.440 | ||
| turn | 0.248 | ||
| sheet | 0.168 | ||