| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338010.1 | 5prime_partial | 200 | 2-604(+) |
Amino Acid sequence : | |||
| HAVHILKISPFASSTPLIINATPFLRFQAKRVVSICSHPKTQFRYSSSSSSSSSSSKRGFRGGVVAMAAPDSVHKSEEDWRAILSPEQFRILRQKGTEYPGTGEYDKFSGEGVYQCAGCS TPLYKSTAKFNSGCGWPAFFEGLPGAINRTPDPDGRRVEITCAACGGHLGHVFKGEGFPTPTDERHCVNSVSLKFTPANS* | |||
Physicochemical properties | |||
| Number of amino acids: | 200 | ||
| Molecular weight: | 13,209.545 | ||
| Theoretical pI: | 9.056 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 53.642 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.658 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.233 | ||
| sheet | 0.275 | ||
| Acc_NO | ORF type | length | start-end position (strand +/-) |
|---|---|---|---|
| >DY338010.1 | complete | 120 | 315-677(+) |
Amino Acid sequence : | |||
| MTSFLVKESTNVQDVALLSTSPQQNSTQAVVGQLSLRVFLEQLIALLTLMAGGSRLPVQLVAVILVMFSRVRVSLPQRMNAIVSIVFPSSLHQQILRSSHLGCDGYHSLYLSCIVYMMIC * | |||
Physicochemical properties | |||
| Number of amino acids: | 120 | ||
| Molecular weight: | 13,209.545 | ||
| Theoretical pI: | 9.056 | ||
| Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 4470 4595 | ||
| Instability index: | 53.642 | ||
| aromaticity | 0.058 | ||
| GRAVY | 0.658 | ||
Secondary Structure Fraction | |||
| Helix | 0.400 | ||
| turn | 0.233 | ||
| sheet | 0.275 | ||