Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338024.1 | 3prime_partial | 255 | 12-776(+) |
Amino Acid sequence : | |||
MPGFLKFLLVFPIFLIISKAASFSQNPILPKAAIFPVSKDPSTLQYITRVFMGGNLERFNLVVDLNGPLLWTASEFHPPIKSCSLKCSMANPTSKTCSLQAENRVSRMSKSANLSEEMMV MEFWDGSGSSSFVNSENFLFLSAPDLLLAGLASEAKGVLGLGDSRISLPSQFSTKFGFFERKFSVCLSSKEGVISLGGTPFSNPMIFTPLISERGGFNQGYCINLGSIKIGNKKLNFHQK GILEARISTIVPYTT | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 14,016.560 | ||
Theoretical pI: | 4.483 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 44.020 | ||
aromaticity | 0.063 | ||
GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.320 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338024.1 | complete | 128 | 625-239(-) |
Amino Acid sequence : | |||
MGFEKGVPPREITPSFDDKQTENFLSKNPNFVENCDGSEILESPNPNTPLASLANPASSKSGADKNKKFSLLTNEDDPLPSQNSITIISSLRFADLDILETLFSACKEQVLEVGFAMEHL REQLLMGG* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,016.560 | ||
Theoretical pI: | 4.483 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 44.020 | ||
aromaticity | 0.063 | ||
GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.320 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338024.1 | 3prime_partial | 255 | 12-776(+) |
Amino Acid sequence : | |||
MPGFLKFLLVFPIFLIISKAASFSQNPILPKAAIFPVSKDPSTLQYITRVFMGGNLERFNLVVDLNGPLLWTASEFHPPIKSCSLKCSMANPTSKTCSLQAENRVSRMSKSANLSEEMMV MEFWDGSGSSSFVNSENFLFLSAPDLLLAGLASEAKGVLGLGDSRISLPSQFSTKFGFFERKFSVCLSSKEGVISLGGTPFSNPMIFTPLISERGGFNQGYCINLGSIKIGNKKLNFHQK GILEARISTIVPYTT | |||
Physicochemical properties | |||
Number of amino acids: | 255 | ||
Molecular weight: | 14,016.560 | ||
Theoretical pI: | 4.483 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 44.020 | ||
aromaticity | 0.063 | ||
GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.320 | ||
sheet | 0.289 |
Acc_NO | ORF type | length | start-end position (strand +/-) |
---|---|---|---|
>DY338024.1 | complete | 128 | 625-239(-) |
Amino Acid sequence : | |||
MGFEKGVPPREITPSFDDKQTENFLSKNPNFVENCDGSEILESPNPNTPLASLANPASSKSGADKNKKFSLLTNEDDPLPSQNSITIISSLRFADLDILETLFSACKEQVLEVGFAMEHL REQLLMGG* | |||
Physicochemical properties | |||
Number of amino acids: | 128 | ||
Molecular weight: | 14,016.560 | ||
Theoretical pI: | 4.483 | ||
Extinction coefficients: assuming all Cys residues are reduced- assuming all pairs of Cys residues form cystines- | 0 125 | ||
Instability index: | 44.020 | ||
aromaticity | 0.063 | ||
GRAVY | -0.427 | ||
Secondary Structure Fraction | |||
Helix | 0.258 | ||
turn | 0.320 | ||
sheet | 0.289 |